Protein Info for AMB_RS19480 in Magnetospirillum magneticum AMB-1

Annotation: UDP-N-acetylmuramate--L-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 PF01225: Mur_ligase" amino acids 10 to 107 (98 residues), 109.1 bits, see alignment E=1.7e-35 TIGR01082: UDP-N-acetylmuramate--L-alanine ligase" amino acids 11 to 458 (448 residues), 536 bits, see alignment E=4.5e-165 PF08245: Mur_ligase_M" amino acids 113 to 299 (187 residues), 93.7 bits, see alignment E=2.3e-30 PF02875: Mur_ligase_C" amino acids 319 to 403 (85 residues), 60.2 bits, see alignment E=3e-20

Best Hits

Swiss-Prot: 100% identical to MURC_MAGSA: UDP-N-acetylmuramate--L-alanine ligase (murC) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 100% identity to mag:amb3849)

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.8

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0H2 at UniProt or InterPro

Protein Sequence (476 amino acids)

>AMB_RS19480 UDP-N-acetylmuramate--L-alanine ligase (Magnetospirillum magneticum AMB-1)
MRTMSLNIGTIHFVGIGGIGMSGIAEILHNLGYSVQGTDIADNYNVERLRKMGIRVHIGH
AAEALGDARVVVVSSAVKADNPEVQAARAKLVPVVRRAEMLAELMRLKSAIAIGGTHGKT
TTTSLIAALLDTARLDPTVINGGIINAYGTNARLGASEWMVVEADESDGSFIKLPSTAVV
VTNIDPEHMDHYGTVERLHEAFRTFVENIPFYGFAAMCIDHPEVQALVARVPDRKLVTYG
FNHQALVRVEKLSMDITGARYDVVITDRVTGATRTIADIHLPMYGEHNVLNSLAAIAVAN
ELGLPNDVVKTALGGFKGVKRRFTRTGEAKGVTVIDDYGHHPVEIAAVLKAARSACQGNV
IAVVQPHRYSRLSSLFAEFCTCFNDADMVIVADVYAAGEKPMEGFDKAALVKGLQEHGHR
RVMALADSKALAPLVNSLAGPGDMVVCLGAGNITSWAHALPADLAALPDPSPGGAE