Protein Info for AMB_RS19465 in Magnetospirillum magneticum AMB-1

Annotation: UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 signal peptide" amino acids 18 to 26 (9 residues), see Phobius details TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase" amino acids 11 to 449 (439 residues), 374.5 bits, see alignment E=4.2e-116 PF08245: Mur_ligase_M" amino acids 115 to 292 (178 residues), 89.7 bits, see alignment E=2.5e-29 PF02875: Mur_ligase_C" amino acids 314 to 428 (115 residues), 34.5 bits, see alignment E=3.4e-12

Best Hits

Swiss-Prot: 100% identical to MURD_MAGSA: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 100% identity to mag:amb3846)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0H5 at UniProt or InterPro

Protein Sequence (457 amino acids)

>AMB_RS19465 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (Magnetospirillum magneticum AMB-1)
MISVPLLKGKRVLVMGLGKSGTATARALLAAGAGVMAWDDGEAARKSGAEAGIPIRDPSL
LPLDKADLLVWSPGIPHTHPQPHPLAEKARAANLPMVCDVELLAQALPGARMLAVTGTNG
KSTTTTLLAHVLDECGLPVAAGGNLGTAALDLPELPGDGRYVLELSSYQLELTHSLKLGV
AILLNVTPDHLGRHGGMAGYIAAKRRVFDFLTPGGAAVVGIDDGPCRAIVAELDRRGIRV
VKISVDSVLAEGVSAPEGVLLDNAKPVCDLKTIPSLPGRHNWQNACAVYAAARAEGLSPK
QIAQALATYPGLAHRQELVGEDHGIAWINDSKATNADAVEKALVCYDHVYWILGGQAKEG
GIASLEKHFGRIQHAFLIGEATEAFAATLDGKVRFTRCATLDKAVAAARNLAVSDSIPGA
VVLLSPACASWDQFTSFEHRGDTFRELVQAFDQGGAA