Protein Info for AMB_RS19410 in Magnetospirillum magneticum AMB-1

Annotation: Kef-type K+ transporter NAD-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 45 to 70 (26 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details PF07885: Ion_trans_2" amino acids 161 to 236 (76 residues), 60.1 bits, see alignment E=2.4e-20 PF00027: cNMP_binding" amino acids 282 to 358 (77 residues), 73.8 bits, see alignment E=1.4e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3833)

Predicted SEED Role

"cAMP-dependent Kef-type K+ transport system" in subsystem Potassium homeostasis or cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0I8 at UniProt or InterPro

Protein Sequence (394 amino acids)

>AMB_RS19410 Kef-type K+ transporter NAD-binding protein (Magnetospirillum magneticum AMB-1)
MIDWLYGLVGEGPFPSMRAMVYRGLLVVCIVLSTTIAIVDTVPDAWIGFEGAVSATGGLF
LVILSLDYILRLVVARAQRGDGESGLAAMARYALSPYGIFDFLAVVPFLVGEATALMPHD
GETVFGILRFLKLARYSPALETLGVVVLHELRPLLASLFIMLILAISASTLIYFTERGAN
PALASVPAAMWWAIVTLSTVGFGDVVPITPLGKLFGSVVAVLGLCMFALPASILASGFAE
EMKRQNFVSTWHLVAKVPFFQRLQASQIAEIAGLLKLARAIKGEVLMREGDTGECMYFIV
SGQVEVKGRAGTFILKNGDFFGEIALIERCPRTATVKAVSRCQLLILDARDFHKFVAHDH
ALLEVIWETARARMAQADHAGDKNAAPPKEKEPV