Protein Info for AMB_RS19350 in Magnetospirillum magneticum AMB-1

Annotation: RNA polymerase-binding protein DksA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 TIGR02420: RNA polymerase-binding protein DksA" amino acids 18 to 127 (110 residues), 148.2 bits, see alignment E=5.4e-48 PF21157: DksA_CC" amino acids 23 to 92 (70 residues), 104.8 bits, see alignment E=2.3e-34 PF01258: zf-dskA_traR" amino acids 95 to 130 (36 residues), 47.8 bits, see alignment E=1.1e-16

Best Hits

Swiss-Prot: 72% identical to DKSA_CAUVN: RNA polymerase-binding transcription factor DksA (dksA) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K06204, DnaK suppressor protein (inferred from 100% identity to mag:amb3822)

Predicted SEED Role

"C4-type zinc finger protein, DksA/TraR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0J9 at UniProt or InterPro

Protein Sequence (138 amino acids)

>AMB_RS19350 RNA polymerase-binding protein DksA (Magnetospirillum magneticum AMB-1)
MTVMLPPDYVPSEDEPFMNDTMKEYFRQKLLRWRAELLRESDETLQHLQEGGMQEPDIAD
RASAEADRALELRTRDRERKLISKIDAAIGRVADGSYGYCEETGEPISIRRLEARPIATL
SIEAQERHERLERTHRED