Protein Info for AMB_RS19300 in Magnetospirillum magneticum AMB-1

Annotation: threonine-phosphate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01140: threonine-phosphate decarboxylase
  • amino acids 7 to 327 (321 residues), 338.4 bits, E=2.2e-105
• PF00155: Aminotran_1_2
  • amino acids 68 to 316 (249 residues), 111.8 bits, E=2.2e-36

Best Hits

KEGG orthology group: K02225, cobalamin biosynthetic protein CobC (inferred from 55% identity to azl:AZL_013470)

Predicted SEED Role

"L-threonine 3-O-phosphate decarboxylase (EC 4.1.1.81)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 4.1.1.81)

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (28/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• aminopropanol phosphate biosynthesis I (1/2 steps found)
• superpathway of L-threonine metabolism (10/18 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.81

Protein Sequence (329 amino acids)

>AMB_RS19300 threonine-phosphate decarboxylase (Magnetospirillum magneticum AMB-1)
MTDLPLHGGDLAAAQARWGHPAQGWLDLSTGINPWPYPLPELPSDCWRRLPESGRHQALL
AVAARRWSVPANARVVAGSGSQALIQALPRITPPTEIAILGPTYGEHARAWSAAGHRVRD
VAGLQEAAASPVVVVVNPNNPDGRVVAPEDLLDLAARQAARGGLLVVDEAFGDERPELSL
TSRLGPGLVVLRSFGKFFGLAGIRLGFAVAEEGLAARLTDHLGPWPVSGPAIELGAQALA
DRVWTEATITRLRDAAARLGDILTRTGLEDLGGTFLFRLARHHQAPALYERLGRAGILVR
AFAFRPDILRFGLPGSEADEQRLRATLAG