Protein Info for AMB_RS19235 in Magnetospirillum magneticum AMB-1

Annotation: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 51% identical to PGSA_RICTY: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA) from Rickettsia typhi (strain ATCC VR-144 / Wilmington)

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 100% identity to mag:amb3799)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

phosphatidylglycerol biosynthesis I (5/6 steps found)
phosphatidylglycerol biosynthesis II (5/6 steps found)
superpathway of phospholipid biosynthesis III (E. coli) (9/12 steps found)
cardiolipin biosynthesis I (2/3 steps found)
cardiolipin biosynthesis II (2/3 steps found)
cardiolipin biosynthesis III (2/3 steps found)
superpathway of cardiolipin biosynthesis (bacteria) (7/13 steps found)
type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)
superpathway of phospholipid biosynthesis II (plants) (9/28 steps found)

KEGG Metabolic Maps

Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0M2 at UniProt or InterPro

Protein Sequence (186 amino acids)

>AMB_RS19235 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (Magnetospirillum magneticum AMB-1)
MLTSLPNLLTLSRIVVIPLVVGLFYVDGDAARWAACALFVAAAVTDWFDGYLARSWNQVS
KFGRFLDPIADKLLVASVLFMLAAFDRLSTVSFLPALVIVLREILVSGLREFLAEVRVGM
PVSRLAKWKTAIQMTAIPVLLVGDAATFMPTRLVGEVGLWAAAILTIITGWDYLRSGMSH
MGESAE