Protein Info for AMB_RS19230 in Magnetospirillum magneticum AMB-1

Annotation: molybdopterin-guanine dinucleotide biosynthesis protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF03205: MobB" amino acids 3 to 135 (133 residues), 175.2 bits, see alignment E=3e-56 TIGR00176: molybdopterin-guanine dinucleotide biosynthesis protein B" amino acids 3 to 159 (157 residues), 133.3 bits, see alignment E=3.8e-43

Best Hits

KEGG orthology group: K03753, molybdopterin-guanine dinucleotide biosynthesis protein B (inferred from 99% identity to mag:amb3798)

Predicted SEED Role

"Molybdopterin-guanine dinucleotide biosynthesis protein MobB" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0M3 at UniProt or InterPro

Protein Sequence (171 amino acids)

>AMB_RS19230 molybdopterin-guanine dinucleotide biosynthesis protein B (Magnetospirillum magneticum AMB-1)
MKVFGIAGRSGMGKTSLIIRLIPWFRAQGITISTVKQAHEAFDVDKKGKDSYEHREAGAS
EVMIASARRWALMHEYRDEPEYSMDQLLARMSAVDLVLVEGFRQWPHPRLEVWRDEVGKP
PLWPEDDRMLALVSDYPAPACPLPQLNVDDTEAIGRLIAERVGLVVERVGL