Protein Info for AMB_RS19160 in Magnetospirillum magneticum AMB-1

Annotation: methyltransferase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 PF22458: RsmF-B_ferredox" amino acids 140 to 211 (72 residues), 56.4 bits, see alignment E=6.8e-19 PF01209: Ubie_methyltran" amino acids 236 to 317 (82 residues), 27.3 bits, see alignment E=5.5e-10 PF01189: Methyltr_RsmB-F" amino acids 236 to 435 (200 residues), 169.3 bits, see alignment E=2.1e-53 PF13847: Methyltransf_31" amino acids 240 to 378 (139 residues), 37.4 bits, see alignment E=5.1e-13

Best Hits

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 100% identity to mag:amb3783)

Predicted SEED Role

"Sun protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0N8 at UniProt or InterPro

Protein Sequence (440 amino acids)

>AMB_RS19160 methyltransferase domain-containing protein (Magnetospirillum magneticum AMB-1)
MTPAARLQAAIEVLSEIEKSAKPADSVASFYFKQRRYIGAKDRRAVAEVVWRVLRRRARI
DWWLEHLDHPERPNAEGKGGSRARVLADMIFEGIKPEPDLFRGPHSAYPPEPPERRVLDM
LAGQKSLFHRDMPPHVRGEYPQWLTPRLAALFGDNLDSEMGAMRDEAPLDLRVNTLKATR
DEAIRALAKEGIKAEPTALSPIGLRLGARVPLVQVQAWRNGLIEVQDEGSQLVALLTDPK
PGQAVVDYCAGAGGKTLALAAAMQNKGRLVACDVAEWRVDRAQDRLRRAGVHNVTRRVIE
GESDKWIKRSAGSFDRVLVDAPCTGTGTWRRNPDAKWQFSETDLLELVARQGAILDSAAR
LTKPGGRLIYATCSIMREENEDRIEAFLAAHPDYRPVPVPELWAELAGTPCPVGGPWLRL
SPQAHGTDGFFAAVLEKAPA