Protein Info for AMB_RS19140 in Magnetospirillum magneticum AMB-1

Annotation: 23S rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF01728: FtsJ" amino acids 59 to 239 (181 residues), 195.3 bits, see alignment E=4.5e-62

Best Hits

Swiss-Prot: 100% identical to RLME_MAGSA: Ribosomal RNA large subunit methyltransferase E (rlmE) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K02427, ribosomal RNA large subunit methyltransferase E [EC: 2.1.1.-] (inferred from 100% identity to mag:amb3779)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0P2 at UniProt or InterPro

Protein Sequence (244 amino acids)

>AMB_RS19140 23S rRNA methyltransferase (Magnetospirillum magneticum AMB-1)
MATGGKKSAGRTTGSGPAGGSRNLTVKVKTAKRRKLSSTLWLQRQLNDPYVHEAKRLGYR
SRAAFKMIQLDERFHILKPGLRVVDLGAAPGGWTQVAVEKVGALKPKGGGKVVGMDILEW
DPLPGAITLQGDFLADDAPDRLKEALGGPADVVLSDMAAPTTGHPSTDHLRIIGLVEVAL
HFALEVLTPGGTFVAKVFQGGTEKTLLDQLKKNFTTVRHAKPPASRQGSAETYVVATGFR
GSSE