Protein Info for AMB_RS18990 in Magnetospirillum magneticum AMB-1

Annotation: Flp pilus assembly protein TadG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF13400: Tad" amino acids 15 to 60 (46 residues), 46.3 bits, see alignment 4.4e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3752)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0R9 at UniProt or InterPro

Protein Sequence (464 amino acids)

>AMB_RS18990 Flp pilus assembly protein TadG (Magnetospirillum magneticum AMB-1)
MIRNSLSRLMTCRKGNMAIILAIGLLPIITTIGLGVDVARAYAVKSRMSAALDAAALAVG
SSSGTDAQLSAVAQKFFDANYPTGALGAHPSVAVKVTGDVISASAVAEVDTVFMKVVGLN
DVPVHADSTVNRQIAGLELAMVLDNTGSMTTNNNIQAVRDAANQLTDILFGTATVHPYLK
IALVPYSAAVNVGSVAPSLITTGDTYAPNDLLGWKGCVVERAGANGVGDTSAATAPWTRY
KWLPAVDNNYDATKSSTVLANPSNGNASTGPNLGCPTAITPLTNVKATLTPAINAMEAWS
RGGTLSDVGMAWGLRVLSPEPPFTEGLPWGTPKWSKAVILMTDGDNQFYKLTSTTGGNKV
NSAVNSDYGAYGRLDELGRIGTTNATTAKTTINTRLTSVCNAMKAKNIIVYTVTFTSGIN
QATKDIYKACATDASKYFDSPSQDELKSAFRAIATSLSNLRVSQ