Protein Info for AMB_RS18900 in Magnetospirillum magneticum AMB-1

Annotation: dienelactone hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02129: Peptidase_S15" amino acids 36 to 180 (145 residues), 46.1 bits, see alignment E=1.1e-15 PF01738: DLH" amino acids 43 to 243 (201 residues), 29.1 bits, see alignment E=1.5e-10 PF12146: Hydrolase_4" amino acids 82 to 178 (97 residues), 27.9 bits, see alignment E=2.8e-10 PF00326: Peptidase_S9" amino acids 84 to 167 (84 residues), 26.8 bits, see alignment E=7e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3734)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0T7 at UniProt or InterPro

Protein Sequence (365 amino acids)

>AMB_RS18900 dienelactone hydrolase (Magnetospirillum magneticum AMB-1)
MHRLFSILFLFLVLAAPARAAGLIEEDTTIEARFRDGTVALEALVVRPDDGRKHPLVVLS
HGAPRKADDREGMRARNQIANAREFARRGWVVVAVMRRGYGESQGEYVESSGRCDDPDYV
KSGRIAADDIRQTIARMAEKPYVDASKVVAVGQSAGGFATVALTADPPPGLVAAISFAGG
RGSTKPDTVCTESRLVDAFRTFGRTSRVPMMWVYTQNDHFFGPALAGRFHKAFTEAGGRA
QFVAAPEFGTDGHYLFSTKGAPQWTGYVERFLASQGLTQFERPLPPRDASAIHYPKGLTE
NGRTAFAKYLDGATHKAFVMSSTGAFGWRTGRKSAEQAVEEATEFCAAHTSKKCYAVMID
DDMVQ