Protein Info for AMB_RS18850 in Magnetospirillum magneticum AMB-1

Annotation: class I poly(R)-hydroxyalkanoic acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01838: poly(R)-hydroxyalkanoic acid synthase, class I
  • amino acids 65 to 594 (530 residues), 812.3 bits, E=8.4e-249
• PF07167: PhaC_N
  • amino acids 108 to 279 (172 residues), 264.3 bits, E=4.5e-83
• PF00561: Abhydrolase_1
  • amino acids 281 to 523 (243 residues), 55.2 bits, E=8.7e-19

Best Hits

Swiss-Prot: 56% identical to PHAC_AZOC5: Poly(3-hydroxyalkanoate) polymerase subunit PhaC (phaC) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K03821, polyhydroxyalkanoate synthase [EC: 2.3.1.-] (inferred from 100% identity to mag:amb3725)

MetaCyc: 45% identical to poly-beta-hydroxybutyrate polymerase subunit (Cupriavidus necator)
RXN1-42 [EC: 2.3.1.304]

Predicted SEED Role

"Polyhydroxyalkanoic acid synthase" in subsystem Polyhydroxybutyrate metabolism

MetaCyc Pathways

• polyhydroxybutanoate biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.304

Sequence Analysis Tools

See Q2W0U6 at UniProt or InterPro

Protein Sequence (598 amino acids)

>AMB_RS18850 class I poly(R)-hydroxyalkanoic acid synthase (Magnetospirillum magneticum AMB-1)
MAEQTGTESKMIDATELSKAMTSIAERSQRIVADFLTRQAADPTAAAADPLNIGNAFMEM
TAKLMSDPAKLVEANLNLWQDYMSLWQNTARRMLGEETQPVVAPDSGDRRFKDEMWQENE
IFDFIKQSYLLSARWMQGVVKNVEGLDDHTAKKVDFYTRQFVDAMAPSNFVLTNPEVLRA
TVETRGENLLKGLNNLLDDLERGKGNLAIKMTDYDAFKVGENIAVTPGKVVFQTDLMQLI
QYDPTTPQAFEKPLLILPPWINKFYILDLRPKNSLIKWAVDQGHTVFVISWVNPDEKLAH
KGFGDYMLEGPLAAIDAIEKATGSRQVNAAGYCLGGTLLACTLAYLAAKGEDRIASATFF
TTMTDFKDPGELGVFIDEEQLSALETRMNQAGFLDGRDMATTFNMMRANDLIWSFVVNNY
LLGKDPFPFDLLYWNSDSTRMPAAMHSFYLRKMYQENRLVEPGAIELNGVKIDLGNIKTP
LYMLSTREDHIAPWQSTYALTQNVSGPIKFVLSASGHIAGVVNPPAANKYCYWTNAKKPK
NPEVWLAGATQVEGSWWTDWQKWVEKFAGKQVPARQPGDGKLKAIEAAPGSYVQVKAV