Protein Info for AMB_RS18845 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1012 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 314 to 336 (23 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 358 to 486 (129 residues), 51.6 bits, see alignment E=5.2e-18 amino acids 657 to 775 (119 residues), 25.5 bits, see alignment E=6.1e-10 PF00989: PAS" amino acids 362 to 477 (116 residues), 56.1 bits, see alignment E=1.4e-18 PF13188: PAS_8" amino acids 362 to 406 (45 residues), 25.4 bits, see alignment (E = 4.1e-09) PF08448: PAS_4" amino acids 369 to 480 (112 residues), 39.7 bits, see alignment E=2.1e-13 amino acids 667 to 770 (104 residues), 58.6 bits, see alignment E=2.7e-19 PF13426: PAS_9" amino acids 372 to 477 (106 residues), 31.2 bits, see alignment E=9.3e-11 amino acids 671 to 768 (98 residues), 21.9 bits, see alignment E=7.2e-08 PF13185: GAF_2" amino acids 528 to 646 (119 residues), 35.9 bits, see alignment E=3.4e-12 PF01590: GAF" amino acids 531 to 644 (114 residues), 43.3 bits, see alignment E=2.1e-14 PF00512: HisKA" amino acids 790 to 856 (67 residues), 45.3 bits, see alignment 3e-15 PF02518: HATPase_c" amino acids 900 to 1009 (110 residues), 96.3 bits, see alignment E=6.5e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3724)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0U7 at UniProt or InterPro

Protein Sequence (1012 amino acids)

>AMB_RS18845 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MTHPPSSPSSAGPTTSAPNAQDQRDSDARRFTRRLVSAVLALNLFVGALVASVLVMSRSQ
HRHQAMAVADNLSTVLRTNLHGTIAKIDLTLLAVADEIARQERVGGVDAAQIEDLLRRHD
ERLPEALGLRVVDASGIIRYGVTGIKVAQASIADRPQFIKMRDDPKAGLVISKPVLGRAA
QTWMVTLSRRLNAPDGSFAGDVHVALPLDKFTESFSAIDVGPQGSVSLWDDGPSILARAP
ELDGPGGVVAKAPKPSPQLLSLIQSGTGKAAYHADSNVDGVARSYHLSRIGSFPLWVIVG
LSEDDYLADWRRQALIMVAVAMGFSLLSVTVATLLLRSWRNRHAAARALEAAHVQTEEAR
HRLELILASAGEGICGVDPEGRITFINPAARRMLGWSETEGVGLNLHEEVHHHRADGSEF
PAVACPVWQTLHDGNIRHVPRDVHWRRDGTPVTVEFTTAPIIQNGRVAGAVTLFRDIARR
IRAESEAARNLAVTTALGGILRHSLEDRRLNDILHDSLVEILSLPWLNVEERGAIFLAQP
DGKTLALVAEHNMSQAIIQACTVIRMGNCLCGAAAERREAVFASHVDERHQTQVPDMHPH
GHYCIPIMNGPDLLGVLNTYIGHGHPWQKEEEHFLRMVADTLAGIIRRKQIEETLRNSEE
LSKTLLNATIDGALLMTPEGRILATNEALAARFATTPAQMPGTSFFDWLPQPLAERRRDQ
FAQVLADRRPLHSVDERGGAIFDNRIYPVQDGDGEIRRMAVFSRDVTEQRHAQKAIEKAL
ADLARSNAELEQFAYVASHDLREPLRAITGHLQLLQRLAKDKLDDYALESLLFAVDGARR
MDLLIRDLLDYSRIGHADREMEDLDLGEVIADALSNLSAAIAEGHATVTTATGMPHAHGN
RMELTRLFQNLIGNALKYRNPERPPEVELRAVRVGGAWDISIRDNGIGIEPEYFNRIFMI
FQRLHGRGQYEGTGIGLAVCRKIVDRHGGSIRVESEPGKGSTFTVTLPVIGG