Protein Info for AMB_RS18835 in Magnetospirillum magneticum AMB-1

Annotation: cytochrome b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 46 to 69 (24 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 8 to 178 (171 residues), 114.3 bits, see alignment E=2.9e-37

Best Hits

KEGG orthology group: K12262, cytochrome b561 (inferred from 100% identity to mag:amb3722)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W0U9 at UniProt or InterPro

Protein Sequence (179 amino acids)

>AMB_RS18835 cytochrome b (Magnetospirillum magneticum AMB-1)
MNTAVPARYDTVARTLHWVMAAAILALWVVGHMIDALPKGPVRSEVIGLHKAIGVVMLVM
AVARLAWRLIRPQPPLPSSMSPGEQLLAKAGHVALYLLMLLIPMDGVLMSQSGGREVSVF
GLVLPALVAKDDALKAIFKEGHEVLGWVLAAILIGHVAAALRHRFILRDDVMARMLPGK