Protein Info for AMB_RS18645 in Magnetospirillum magneticum AMB-1

Annotation: 7-carboxy-7-deazaguanine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 TIGR04508: 7-carboxy-7-deazaguanine synthase" amino acids 3 to 202 (200 residues), 285.4 bits, see alignment E=1.5e-89 PF04055: Radical_SAM" amino acids 46 to 123 (78 residues), 31.7 bits, see alignment E=8.8e-12

Best Hits

Swiss-Prot: 59% identical to QUEE_BRADU: 7-carboxy-7-deazaguanine synthase (queE) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: None (inferred from 58% identity to bug:BC1001_0059)

Predicted SEED Role

"Queuosine Biosynthesis QueE Radical SAM" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>AMB_RS18645 7-carboxy-7-deazaguanine synthase (Magnetospirillum magneticum AMB-1)
MSYKVKEIFYSLQGEGAHSGRPAIFCRFSNCNLWSGKEEDRADAVCKFCDTDFVGGQEYT
IEGLVQAISAKWPGGGKPYVICTGGEPLLQVDIPLVDALHVAGFEVAVETNGTVGKHDVA
AKLDWVCVSPKADARVKLDRGHELKLVYPQTENHPSDFERMAFKHFFLQPCDGVEGSTAM
AIDYCLAHPHWSLSLQTHKIGGFE