Protein Info for AMB_RS18520 in Magnetospirillum magneticum AMB-1

Annotation: B12-binding domain-containing radical SAM protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 transmembrane" amino acids 338 to 356 (19 residues), see Phobius details amino acids 442 to 462 (21 residues), see Phobius details amino acids 473 to 490 (18 residues), see Phobius details PF02310: B12-binding" amino acids 33 to 126 (94 residues), 32.5 bits, see alignment E=1e-11 PF04055: Radical_SAM" amino acids 172 to 338 (167 residues), 80.9 bits, see alignment E=1.9e-26 PF13282: DUF4070" amino acids 358 to 427 (70 residues), 31.6 bits, see alignment E=2.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3660)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W111 at UniProt or InterPro

Protein Sequence (504 amino acids)

>AMB_RS18520 B12-binding domain-containing radical SAM protein (Magnetospirillum magneticum AMB-1)
MPSLLLINPRFPESFWSFRWAIDHVLPGKKAVNPPLGLATLAALCPALWRVEIIDENIEP
IPPTTDADIVGVCGMGVQFERQRELLAHYRDQGHYVVAGGSYASLCPDEYTEAADTVVAG
EAEYVWPEFCRDFEAGTPKPLYHETGTVALADTPVPRYDLLRLGAYSNVTLQFSRGCPFR
CEFCDIIVMFGRRPRVKDLDQIEKELDQLRRFGARSVFFVDDNLIGNPKEAKDLLRFLAE
YQRHHGYMFSFGTEASLNMAQDDELLELFRAANFGWVFIGIETTDPVGLKETGKTQNLRE
DTLTAIRRIYSHGIDVLGGFIIGFDHDTLDTFEHQYRFITDAGIQSAMIGLLMALPRTPL
HARMEREGRLLPVERHSDNTSLTTNIVPKCMTAEAMAAGYQMLYGRLLTGPEIGRRIRNK
AAYLRVPVYGSGYPMGQRVGIVVRLLVRGILSGGLTTMVPFLRSFPFLTPSRIPMVISDW
IIGLSMKAFAERHLTGTARRREAD