Protein Info for AMB_RS18405 in Magnetospirillum magneticum AMB-1

Annotation: proline--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 TIGR00408: proline--tRNA ligase" amino acids 13 to 500 (488 residues), 457.9 bits, see alignment E=2.3e-141 PF00587: tRNA-synt_2b" amino acids 116 to 283 (168 residues), 59.6 bits, see alignment E=6.4e-20 PF03129: HGTP_anticodon" amino acids 303 to 397 (95 residues), 21.9 bits, see alignment E=2.3e-08 PF09180: ProRS-C_1" amino acids 445 to 500 (56 residues), 41.1 bits, see alignment 2.5e-14

Best Hits

Swiss-Prot: 100% identical to SYP_MAGSA: Proline--tRNA ligase (proS) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K01881, prolyl-tRNA synthetase [EC: 6.1.1.15] (inferred from 100% identity to mag:amb3636)

Predicted SEED Role

"Prolyl-tRNA synthetase (EC 6.1.1.15), archaeal/eukaryal type" (EC 6.1.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W136 at UniProt or InterPro

Protein Sequence (500 amino acids)

>AMB_RS18405 proline--tRNA ligase (Magnetospirillum magneticum AMB-1)
MSKAKKTAVTPTREENFPEWYQQVIKASDMAENSPVRGCMVIKPWGYGIWEAIQRDLDRR
IKETGHENCYFPLFIPLSFLEKEAAHVEGFAKEMAVVTHHRLVAEDGKLVPSGKLEEPLV
VRPTSETIIGDAFARWIQSYRDLPMLVNQWANVVRWEMRPRIFLRTAEFLWQEGHTAHAT
AEEAMDETLKMLEVYRVMAEEVLAMPVIVGEKPAHERFPGADKTYSIEAMMQDGKALQAG
TSHFLGQHFSKAQNIRYQTAQGGEEFCYTTSWGVSTRLIGGVIMSHADDNGLRVPPRIAP
KQIVFVPITRADGDEALIEDFLAPIVKDLSAQSFGGERLRVHVDRRPLAPPEKRWEWVKK
GAPIICEVGPRDVAGGSVAMIRRDGELKGQITPKDELVSRAAAILEDIQKTLFTQAATAL
KERTVTVRTLDDFLAVFADDTTFGRKFVRARWCGDSDTLAKLDEYSITIRNVPFDQDGEA
GTCVLSGRPATQEVIFAKSY