Protein Info for AMB_RS18325 in Magnetospirillum magneticum AMB-1

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF13489: Methyltransf_23" amino acids 40 to 175 (136 residues), 45.2 bits, see alignment E=3.7e-15 PF05175: MTS" amino acids 46 to 143 (98 residues), 43.3 bits, see alignment E=1.5e-14 PF01209: Ubie_methyltran" amino acids 50 to 182 (133 residues), 34.4 bits, see alignment E=7.1e-12 PF13847: Methyltransf_31" amino acids 51 to 157 (107 residues), 54.2 bits, see alignment E=6.4e-18 PF00891: Methyltransf_2" amino acids 53 to 163 (111 residues), 23.9 bits, see alignment E=1.1e-08 PF13649: Methyltransf_25" amino acids 54 to 149 (96 residues), 74.7 bits, see alignment E=3.4e-24 PF08242: Methyltransf_12" amino acids 55 to 150 (96 residues), 61.1 bits, see alignment E=6.3e-20 PF08241: Methyltransf_11" amino acids 55 to 152 (98 residues), 55.2 bits, see alignment E=4.2e-18

Best Hits

KEGG orthology group: K15256, tRNA (cmo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to mag:amb3620)

Predicted SEED Role

"tRNA (uridine-5-oxyacetic acid methyl ester) 34 synthase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W151 at UniProt or InterPro

Protein Sequence (233 amino acids)

>AMB_RS18325 class I SAM-dependent methyltransferase (Magnetospirillum magneticum AMB-1)
MSGKVNMTLTIEAAFNRAARSYDGLRRQLIPCFDDFYGAALDLVTEFAPPGARILDLGAG
TGLLSALVAERRPDVRLVLTDLAEDMLERARERFAAHPVPVEFRVMNHLDLAEEGAYDVV
MSALSIHHLEDEGKRAVYAAMARAVRPGGAVVNADQVAGDTAEMEARYWSHWHEAIQRAG
LPVDEIAAAIERQTLDRRTPLAPQLDWLRRAGLEQVECRYKNVSFAVMAGLRK