Protein Info for AMB_RS18170 in Magnetospirillum magneticum AMB-1

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 42 to 86 (45 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 189 to 214 (26 residues), see Phobius details amino acids 226 to 251 (26 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 10 to 280 (271 residues), 113.6 bits, see alignment E=4.9e-37

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to mag:amb3590)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W181 at UniProt or InterPro

Protein Sequence (297 amino acids)

>AMB_RS18170 branched-chain amino acid ABC transporter permease (Magnetospirillum magneticum AMB-1)
MGSSLLLQLLVNGLIVGTLYGVVAMCFVLIYKSTQVVNFAQGEFLLIGAWTCWWLVTSMA
LPFYVAFPMTFLFMMVFGIALQMIVLRPLIGEPVISVIMVTIGLSIFFQAVMKSIFGVWA
QPFPEIFPVKSVDILGLSVQPAYLMSLVVSIVIMGLFAWFFKYSRMGLAMRATAFNQQVA
QSLGISVKAVFATAWAISAMVSALAGVVVGMVNGVSSALSFFGIKVFPAVIVGGLDSIIG
AVLGGLIIGVLENLAEYADGQYLHLGNLYTVAPFYVLVIILMIKPYGLFGTKTIERV