Protein Info for AMB_RS18095 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 193 to 216 (24 residues), see Phobius details amino acids 228 to 244 (17 residues), see Phobius details amino acids 250 to 267 (18 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details amino acids 395 to 414 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3575)

Predicted SEED Role

"FIG00779858: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W196 at UniProt or InterPro

Protein Sequence (431 amino acids)

>AMB_RS18095 hypothetical protein (Magnetospirillum magneticum AMB-1)
MFPGSFMMGAKDRLLPPSIPYRFFVAAVFFHLLAWVLLLVGNEGVIGFVGGQGMTLAALH
LITLGTLAMTAMGAAIQLLPVATRRPLGPIWAIKLMFILYAPGVALFAGGLAHSIPWAQH
GGATLCVAGLALFGGLVGANLRKVDDLPGVTRHAWLAVASLIGLAVLGLVLVVDFTKGFL
PDHASVAAAHAVLAGYGFMGMLALGFSYVLIPMFVLGSAVPDVVGKRTALLSGLGLALGA
GGALTGQGLVAALGILLGLAACGVYLHGMRASLKSRMKKRLEPFFRVVWVAWALLPVSLL
AGLAPALGAPLDPWASLWGFLLVFGWLLSFVTAILQRIMPFLASMHSSALGGKPALLSHL
SPKLPVDIHLGCHAAALVLVCVALIGGWVWPLRLGLIAGLVGAVAFGVYTVEVLRRYRSH
MAAAAAAHQQG