Protein Info for AMB_RS17990 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 986 transmembrane" amino acids 166 to 187 (22 residues), see Phobius details amino acids 351 to 374 (24 residues), see Phobius details PF13188: PAS_8" amino acids 15 to 63 (49 residues), 21.7 bits, see alignment 5.1e-08 PF13426: PAS_9" amino acids 19 to 114 (96 residues), 45.9 bits, see alignment E=2e-15 TIGR00229: PAS domain S-box protein" amino acids 24 to 114 (91 residues), 44.5 bits, see alignment E=8.2e-16 PF00989: PAS" amino acids 24 to 112 (89 residues), 35.5 bits, see alignment E=3.1e-12 PF08447: PAS_3" amino acids 31 to 114 (84 residues), 59.2 bits, see alignment E=1.4e-19 PF02203: TarH" amino acids 163 to 334 (172 residues), 88.8 bits, see alignment E=1.5e-28 PF12729: 4HB_MCP_1" amino acids 163 to 342 (180 residues), 64.9 bits, see alignment E=2.6e-21 PF00015: MCPsignal" amino acids 520 to 686 (167 residues), 87.4 bits, see alignment E=3.6e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3554)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1B7 at UniProt or InterPro

Protein Sequence (986 amino acids)

>AMB_RS17990 PAS domain-containing protein (Magnetospirillum magneticum AMB-1)
MRVNEPITNHEIELPEGTILVSKTDLGGRITFVNQAFIEISGYTEEELIGAPHNLVRHPH
MPPVAFADLWNTIKAGKPWEGIVKNRAKNGDHYWVRANATPEMEGGQITGYISIRTAPTR
AQVEAAEHLYEQVRSGKARNIKVEEGRVLSTTAAARLGRALNSISGRLALIIAIMVMVMG
TVAWFTLDGMADSNEALKRVYQQRTVPAGQFVEIIDRMRENLLLVHQMQIDLNNGQADAI
PRRTLRVRANAEHISAVWSAYRANPLPAEEAELAGDFETRRKDFVEQGLLVALDLAEKGD
AATLGRHIATGVQPQFEQVHEVLKDLLSLQLRQASELYEGARTDYGHHMRLGIGTLVGGT
LLATLMALVLIRYLRRPIATLEYHFDAIARGDFTHEIQAEEVREFQRSSALLRAMEAKLA
YAVQERAENARKAQEKLRSEMLNLTELLEGEVDNTVAEISTQAERLKEGAAHLLATAEEL
RDKSETVARAIEITSGNVQTVAGATEELEASSREITARIQSSSEHSEAARHRVDEASSSV
GTLTEATARIGDVVSLIQAIAGQTRMLALNATIEAARAGDAGKGFAVVASEVKGLAEQTE
DAIGRVNAQARDIESTTQKAVATVEAVADTIRDMEQIAGQIAASADEQRAATGEIMSSAV
QAADHTRDVADAAADVLKASEQTGVTARKVSELSMLVNHDIGALQRRLNVILRTSYGGNR
RAVERIPASLEFTATFAGRTFSGHTGDISLMGALLVVGDAPKLEGEIGSITFPGVGEIPT
KAILGSRLGIQCQYLKVGQDIKQRLSAAIQAAQANDAPFIATAQKAAADVARAFEQAVNA
GRISLAELFECEYTPVLDTDPQQMLAHHTQVADQVIPAIIEPALASDSRAVFCCVADRNG
YIATHNKIYSQPQRPNDPVWNTANCRNRRMFDDRTGILAARNTKEYLAQTYARDMGGGNF
VVLKEIDCPINVGNRHWGSVRYGIKL