Protein Info for AMB_RS17970 in Magnetospirillum magneticum AMB-1

Annotation: MotA/TolQ/ExbB proton channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 60 to 80 (21 residues), see Phobius details amino acids 164 to 188 (25 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details PF01618: MotA_ExbB" amino acids 135 to 239 (105 residues), 103.2 bits, see alignment E=4.6e-34

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 100% identity to mag:amb3550)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1C1 at UniProt or InterPro

Protein Sequence (266 amino acids)

>AMB_RS17970 MotA/TolQ/ExbB proton channel family protein (Magnetospirillum magneticum AMB-1)
MTGNKIMIRASLAALPVLFLAGAALAGHADEGHAVARQVVDNPYGLDALWAQGDFVSKGT
LIILALMSMASWYILVVKLIEQSRLMRHAKAAAAGFWKAASVADGARALAEDSPFRFVAS
AGMEAAQHHEGALTEKIDLNTWVTMSIQRAVGEIVSELQGGLAVLATVGSTAPFVGLFGT
VWGIYHALTAIGIAGQAAIDKVAGPVGEALIMTAFGLAVAVPAVLGYNLLVRRNKLAAEK
VRAFAADLHAVLLAGSSGGGNLRVVR