Protein Info for AMB_RS17780 in Magnetospirillum magneticum AMB-1

Annotation: rod shape-determining protein MreD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 62 to 91 (30 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details TIGR03426: rod shape-determining protein MreD" amino acids 14 to 160 (147 residues), 75.3 bits, see alignment E=2.5e-25 PF04093: MreD" amino acids 14 to 156 (143 residues), 41.1 bits, see alignment E=1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3515)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1F6 at UniProt or InterPro

Protein Sequence (171 amino acids)

>AMB_RS17780 rod shape-determining protein MreD (Magnetospirillum magneticum AMB-1)
MKSSVWVRMDTWVRHLVPFGITVFLLLLTAIPTHIPGFSGIAPMLPLMGVYYWAIYRPDL
LPAWLAFVIGLLYDIVAGTPLGVNALVMLLVQGTAASQRKFFLGKSFAVTWWAFSLLTAG
AIGMAWMLLSFVKGRPLDVAPVVFEYLMTLALFPLLTWTLARTQLAFLRDV