Protein Info for AMB_RS17750 in Magnetospirillum magneticum AMB-1

Annotation: ketol-acid reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to ILVC_MAGSA: Ketol-acid reductoisomerase (NADP(+)) (ilvC) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00053, ketol-acid reductoisomerase [EC: 1.1.1.86] (inferred from 100% identity to mag:amb3509)

MetaCyc: 67% identical to acetohydroxyacid isomeroreductase (Cupriavidus necator H16)
Ketol-acid reductoisomerase. [EC: 1.1.1.86]; 1.1.1.86 [EC: 1.1.1.86]

Predicted SEED Role

"Ketol-acid reductoisomerase (EC 1.1.1.86)" in subsystem Branched-Chain Amino Acid Biosynthesis or Coenzyme A Biosynthesis (EC 1.1.1.86)

MetaCyc Pathways

superpathway of branched chain amino acid biosynthesis (16/17 steps found)
superpathway of L-isoleucine biosynthesis I (12/13 steps found)
superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
L-valine biosynthesis (4/4 steps found)
phosphopantothenate biosynthesis I (4/4 steps found)
L-isoleucine biosynthesis I (from threonine) (6/7 steps found)
superpathway of coenzyme A biosynthesis II (plants) (7/10 steps found)
pyruvate fermentation to isobutanol (engineered) (3/5 steps found)
phosphopantothenate biosynthesis III (archaea) (2/4 steps found)
L-isoleucine biosynthesis III (4/7 steps found)
superpathway of L-threonine metabolism (10/18 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.86

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1G2 at UniProt or InterPro

Protein Sequence (339 amino acids)

>AMB_RS17750 ketol-acid reductoisomerase (Magnetospirillum magneticum AMB-1)
MRVYYDRDADVNLIKGKKVVVVGYGSQGHAHALNLRDSGVKDVAVALRAGSATAKKAEGE
GLKVMTPADAAKWGDVVMILTPDELQADLYYNDLAANMKQGASLVFAHGLNIHFKLIEAR
ADLDVFMVAPKGPGHTVRGEYVKGGGVPCLVAVAQNASGNALEIALSYASAIGGGRSGII
ETSFREECETDLFGEQVVLCGGLTKLIQYGFETLVEAGYAPEMAYFECLHEVKLIVDLIY
EGGIANMRYSISNTAEYGDYVTGPRIITDETKAEMKRVLEDIQAGRFVRDWMLECKAGQP
SFKATRRIQAEHGIEVVGEKLRAMMPWIAKNKLVDKAKN