Protein Info for AMB_RS17745 in Magnetospirillum magneticum AMB-1

Annotation: acetolactate synthase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00119: acetolactate synthase, small subunit
  • amino acids 10 to 168 (159 residues), 181.4 bits, E=5.8e-58
• PF01842: ACT
  • amino acids 11 to 76 (66 residues), 42.2 bits, E=7.9e-15
• PF13710: ACT_5
  • amino acids 20 to 82 (63 residues), 40.2 bits, E=3.7e-14
• PF10369: ALS_ss_C
  • amino acids 94 to 167 (74 residues), 92.4 bits, E=2.4e-30

Best Hits

Swiss-Prot: 46% identical to ILVH_AQUAE: Acetolactate synthase small subunit (ilvH) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K01653, acetolactate synthase I/III small subunit [EC: 2.2.1.6] (inferred from 100% identity to mag:amb3508)

MetaCyc: 54% identical to acetohydroxyacid synthase subunit H (Cupriavidus necator H16)
Acetolactate synthase. [EC: 2.2.1.6]; 2.2.1.6 [EC: 2.2.1.6]

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (16/17 steps found)
• superpathway of L-isoleucine biosynthesis I (12/13 steps found)
• L-valine biosynthesis (4/4 steps found)
• L-isoleucine biosynthesis I (from threonine) (6/7 steps found)
• pyruvate fermentation to (R)-acetoin I (2/3 steps found)
• pyruvate fermentation to (S)-acetoin (2/3 steps found)
• L-isoleucine biosynthesis IV (4/6 steps found)
• pyruvate fermentation to (R)-acetoin II (1/2 steps found)
• pyruvate fermentation to isobutanol (engineered) (3/5 steps found)
• L-isoleucine biosynthesis II (5/8 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• superpathway of (R,R)-butanediol biosynthesis (2/5 steps found)
• superpathway of 2,3-butanediol biosynthesis (2/6 steps found)
• superpathway of L-threonine metabolism (10/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

See Q2W1G3 at UniProt or InterPro

Protein Sequence (171 amino acids)

>AMB_RS17745 acetolactate synthase small subunit (Magnetospirillum magneticum AMB-1)
MTIAKQEINRHTIAVLVDNESGVLARVVGLFSGRGYNIESLTVAEVDAGEKLSRITIVTS
GTAMIIEQIKNQLRRLVPVYKVHDLTIEGPHVSRELALVKVAATGDKRVESLRIADIFRA
RAIDSTNESFVFEVVGATDKVDAFIKLMEPLGLTDVSRTGVVAIARGPNPI