Protein Info for AMB_RS17695 in Magnetospirillum magneticum AMB-1

Annotation: flagellar motor switch protein FliM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 TIGR01397: flagellar motor switch protein FliM" amino acids 77 to 387 (311 residues), 303.9 bits, see alignment E=6.4e-95 PF02154: FliM" amino acids 107 to 297 (191 residues), 219.8 bits, see alignment E=3.1e-69 PF01052: FliMN_C" amino acids 318 to 387 (70 residues), 65.5 bits, see alignment E=3.4e-22

Best Hits

KEGG orthology group: K02416, flagellar motor switch protein FliM (inferred from 100% identity to mag:amb3498)

Predicted SEED Role

"Flagellar motor switch protein FliM" in subsystem Bacterial Chemotaxis or Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1H3 at UniProt or InterPro

Protein Sequence (393 amino acids)

>AMB_RS17695 flagellar motor switch protein FliM (Magnetospirillum magneticum AMB-1)
MAMNDDGGTTRGADDEEALMKEWAAMAGDDAGGGGGGGGGDAGGGDGGDMAAEWEAMLGA
GDSTGETQAAVAKDATRVLNQDEIDSLLGFDDDMGGANDKSGIQAILNSALVSYERLPML
EVVFDRLVRMMSTSMRNFTSDNVEVSLDNILSLRFGDYLNSIPLPAMLAVFKAEEWDNFG
LLTVDSSLIYSIVDVLLGGRRGTAAMRIEGRPYTTIERNLVERMVHVVLSDLSAAFDPLS
PVTFRFDRLETNPRFATISRPSNAAIVAKLRIDMEDRGGRLELLLPYATLEPVRELLLQM
FMGEKFGRDSIWETHLAEELWLTEVELEAVLDEQVMNLREVLNWKPGSKFMLNATADSQI
DMRCGEVAMFRGRMGRKGQHIAIQVDESTIKSG