Protein Info for AMB_RS17645 in Magnetospirillum magneticum AMB-1

Annotation: iron-sulfur cluster carrier protein ApbC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF01883: FeS_assembly_P" amino acids 6 to 76 (71 residues), 57.1 bits, see alignment E=5.9e-19 PF10609: ParA" amino acids 108 to 351 (244 residues), 353.7 bits, see alignment E=1.8e-109 PF13614: AAA_31" amino acids 112 to 148 (37 residues), 34.1 bits, see alignment 9.8e-12 PF09140: MipZ" amino acids 112 to 258 (147 residues), 32.4 bits, see alignment E=2.2e-11 PF01656: CbiA" amino acids 113 to 330 (218 residues), 49.5 bits, see alignment E=1.4e-16

Best Hits

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 100% identity to mag:amb3487)

Predicted SEED Role

"Cytosolic Fe-S cluster assembling factor NBP35 / Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1I4 at UniProt or InterPro

Protein Sequence (370 amino acids)

>AMB_RS17645 iron-sulfur cluster carrier protein ApbC (Magnetospirillum magneticum AMB-1)
MAEVTEQQIIEALSRIIDPDRKADIVGLGMVSGLTLKGGHVAFAIEVDPQRGPHLEPLRK
AAEKAVHDLPGVLSVSAVLTAERNTQGGPKGAPQGGHGHQAEKPLLPNVKAIVAIASGKG
GVGKSTTATNIAMALSRMGLKVGLFDADIFGPSMPRMLGITGEPVSPDGQTMMPMENYGV
KCMSMGFLVPEDSPIIWRGPMVMGALEQLLRDVHWGELDVMIIDMPPGTGDTQLTMTQRV
PLTGAVIVSTPQDIALLDATKGLNMFRKVDVPVLGIIENMSYYICPKCGDEAHIFGHGGA
KAEAARLSADFLGEIPLDISIRQTADAGEPIVISKPNSPHAKVYMEIAARIWDKVQVLQS
SRKGPRIVME