Protein Info for AMB_RS17630 in Magnetospirillum magneticum AMB-1

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 293 to 323 (31 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details TIGR03472: hopanoid biosynthesis associated glycosyl transferase protein HpnI" amino acids 6 to 378 (373 residues), 530.6 bits, see alignment E=9.4e-164 PF13506: Glyco_transf_21" amino acids 12 to 375 (364 residues), 313.2 bits, see alignment E=4.3e-97 PF13641: Glyco_tranf_2_3" amino acids 45 to 275 (231 residues), 90 bits, see alignment E=4e-29 PF00535: Glycos_transf_2" amino acids 51 to 218 (168 residues), 29.3 bits, see alignment E=1.6e-10 PF13632: Glyco_trans_2_3" amino acids 134 to 319 (186 residues), 44.1 bits, see alignment E=4.2e-15

Best Hits

KEGG orthology group: K00720, ceramide glucosyltransferase [EC: 2.4.1.80] (inferred from 100% identity to mag:amb3484)

Predicted SEED Role

"Ceramide glucosyltransferase (EC 2.4.1.80)" (EC 2.4.1.80)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1I7 at UniProt or InterPro

Protein Sequence (384 amino acids)

>AMB_RS17630 glycosyl transferase (Magnetospirillum magneticum AMB-1)
MMFVWQGLCLVLIALTVAGCLFQVASAALVRRFRRAPEPVPAARPPISVMKPLCGAEHGM
AANLDSCLRQDYPRFQLVFGVADPADPALDVVKALPGDVEGAEIDWVADSARHGHNLKVG
NLLNMWPKVRHDVIAIADSDIRVGPHYLDDLAAPFDDPKVGIVTCLYVGRPEPDLWSSLG
AMGINHGFLPGAVLARAIGRKDGCFGATMAVRREVLEKGGGLAALSQVLADDWVLGRMVR
DQGLEIVLAARPVDMNVHEPSLKTLLDHEIRWGRTIAAVDRTSYMASVITQPVALAALAV
LAGGAWWPSVAALALAVLCRLWAVRVEERALGLPRCGLGLLGMREILSFVVYVVACCGRT
VVWRGRRFAVRADGTLDQVEGSQT