Protein Info for AMB_RS17615 in Magnetospirillum magneticum AMB-1

Annotation: PDZ domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details TIGR02037: peptidase Do" amino acids 53 to 479 (427 residues), 489.1 bits, see alignment E=6.3e-151 PF00089: Trypsin" amino acids 106 to 265 (160 residues), 77.2 bits, see alignment E=5.2e-25 PF13365: Trypsin_2" amino acids 107 to 243 (137 residues), 127.6 bits, see alignment E=2e-40 PF13180: PDZ_2" amino acids 297 to 373 (77 residues), 48.3 bits, see alignment E=3.1e-16 PF00595: PDZ" amino acids 413 to 458 (46 residues), 24.6 bits, see alignment 7.9e-09 PF17820: PDZ_6" amino acids 423 to 470 (48 residues), 34.9 bits, see alignment 3.3e-12

Best Hits

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 100% identity to mag:amb3481)

Predicted SEED Role

"Serine protease precursor MucD/AlgY associated with sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1J0 at UniProt or InterPro

Protein Sequence (482 amino acids)

>AMB_RS17615 PDZ domain-containing protein (Magnetospirillum magneticum AMB-1)
MTLYREAVFPVQRVAMTMSFKSLAAALALVILVPAAQAQTQVVPGSREQVKLTFAPVARQ
VAPAVVNIYTKRVVRAAASPLFADPFFRRFFGDVPGMSQERVQRSLGSGVLIAADGTVVT
NHHVIKDADEVTVVLSDRREFEARIVGSDDRTDLAVLKIDGGRESFPTLTLGDSDAIEVG
DVVMAVGNPFGVGQTVTQGIVSALARTNVGVSDVQSFIQTDAAINPGNSGGALVDLQGRL
IGINTAIYSKDGGSNGIGFAIPTALVRQVAASIAKGGKVVRPWLGASGQAVTADLAQALK
LPRPIGVLVNHIHGESPAARGGLADGDIIVAVEGREVDDPEGMRFRLATLPIGADARLTV
LRNGAERTITVRLVAPPETPPRDKTDIAGRNPFSGATLVNLNPALAEEIGINSGLTGVMI
FAIKRGSVANRLGLQPGDMLMKINERPVSSVADARRLLEAEQPRWAITIKRNGEVMSLVL
GG