Protein Info for AMB_RS17600 in Magnetospirillum magneticum AMB-1

Annotation: DNA-directed RNA polymerase specialized sigma subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 PF04542: Sigma70_r2" amino acids 16 to 76 (61 residues), 44.8 bits, see alignment E=1.4e-15 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 16 to 154 (139 residues), 47.8 bits, see alignment E=6.3e-17 PF08281: Sigma70_r4_2" amino acids 103 to 153 (51 residues), 51 bits, see alignment 1.4e-17 PF04545: Sigma70_r4" amino acids 106 to 154 (49 residues), 30.8 bits, see alignment 2.5e-11

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to mag:amb3478)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1J3 at UniProt or InterPro

Protein Sequence (288 amino acids)

>AMB_RS17600 DNA-directed RNA polymerase specialized sigma subunit (Magnetospirillum magneticum AMB-1)
MAEGQSPALVHFLAQRPRLRLLAYRLLGSTADAEDVLQDAWLKWSRGSDGVEEPAAFLTT
QVTRLALDRLRKDQRRARLGAQWLPDPWVEPLEPGEADLSTGLLLLLERLTPDQRAVYVL
REAMDLDFADIAAILGKSVATCRQIMSRARAALKGEARFDWDAAQTGTLVRRFAAACDQR
DYGALVALLGGESRLISDGGGKVKSARNPIRGPDRIARFILGVRRKFQPADFAFRIAEIN
GLPALVGETKGDVRWALTFGCIGGRIGGIYLLADPDRLPDYSTISSSA