Protein Info for AMB_RS17530 in Magnetospirillum magneticum AMB-1

Annotation: nif-specific transcriptional activator NifA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 TIGR01817: Nif-specific regulatory protein" amino acids 13 to 565 (553 residues), 699.3 bits, see alignment E=1.8e-214 PF13185: GAF_2" amino acids 27 to 169 (143 residues), 35.2 bits, see alignment E=6.3e-12 PF01590: GAF" amino acids 28 to 169 (142 residues), 48.4 bits, see alignment E=6.5e-16 PF01078: Mg_chelatase" amino acids 207 to 351 (145 residues), 22.5 bits, see alignment E=3.1e-08 PF14532: Sigma54_activ_2" amino acids 211 to 381 (171 residues), 72.1 bits, see alignment E=2.6e-23 PF00158: Sigma54_activat" amino acids 211 to 376 (166 residues), 244.8 bits, see alignment E=1.7e-76 PF07724: AAA_2" amino acids 231 to 351 (121 residues), 28.4 bits, see alignment E=7.3e-10 PF07728: AAA_5" amino acids 234 to 352 (119 residues), 37.5 bits, see alignment E=1e-12 PF00004: AAA" amino acids 234 to 352 (119 residues), 23.9 bits, see alignment E=2.3e-08 PF02954: HTH_8" amino acids 522 to 557 (36 residues), 49.6 bits, see alignment 1.2e-16

Best Hits

KEGG orthology group: K02584, Nif-specific regulatory protein (inferred from 100% identity to mag:amb3464)

Predicted SEED Role

"Nitrogenase (molybdenum-iron)-specific transcriptional regulator NifA" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1K7 at UniProt or InterPro

Protein Sequence (565 amino acids)

>AMB_RS17530 nif-specific transcriptional activator NifA (Magnetospirillum magneticum AMB-1)
MTAQKSDESALPLIGIYEISKILGATLDLDKALHDVLNVLASYLNMRHGAVVLKDEAGKP
HLAAVTGMSLRLAREGVLKYPFAAVEKVMNTGIPMVVPDAAEEPLLVEYIAENDDSLEDE
RLSFFCVPIKTTDKPFGALSVERSWSDSAQYVFEHDLRFLTMVATLIGQTASLHRKLAND
RETLMTDAARLHKRMAEVRPTLPIRGLEDVVGTSEAMARVFAQVQQAAPTKATILLRGES
GTGKELVARAIHILSARAQKPFIKVNCAALSESVLESELFGHEKGAFTGAVADRKGRFEL
SSGGTLFLDEIGEISSNFQAKLLRVLQEGEFERVGGNKTVKVDVRLIAATNRDLEAGVAD
GSFRADLYYRLNVVPLFLPPLRERSGDIPLLAMYFLKQFNEENGRGLAFSQNALEALQRC
YFPGNVRELENCVYRTATMTKGEVIDEMDLSCKQDTCLSSTLWHKRNPGDKAAPTLSAPI
PVPTGPMIPPAAAAPVAPPQPRPDIPAPSAADPTPPDEDLSERERLVQAMERCGWVQAKA
ARLLGLTPRQIGYALKKHNIEIQQL