Protein Info for AMB_RS17505 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details PF00672: HAMP" amino acids 185 to 233 (49 residues), 38.1 bits, see alignment 4.8e-13 TIGR00229: PAS domain S-box protein" amino acids 242 to 362 (121 residues), 59.4 bits, see alignment E=2e-20 PF08448: PAS_4" amino acids 261 to 361 (101 residues), 27 bits, see alignment E=1.3e-09 PF00989: PAS" amino acids 262 to 357 (96 residues), 26.3 bits, see alignment E=1.9e-09 PF13426: PAS_9" amino acids 262 to 359 (98 residues), 27.9 bits, see alignment E=7.2e-10 PF08447: PAS_3" amino acids 270 to 349 (80 residues), 45.7 bits, see alignment E=2e-15 PF02518: HATPase_c" amino acids 484 to 594 (111 residues), 85.3 bits, see alignment E=1.2e-27

Best Hits

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (600 amino acids)

>AMB_RS17505 PAS domain-containing sensor histidine kinase (Magnetospirillum magneticum AMB-1)
MTFGYARPPSVRPVHSLRLRLLAFSVLVELVMLTLLVTNSVRLIQTHLSDSTELRLQAQE
ASYNITLAGQLAERDYAALQSIIEGWGASKSITYMVVTNTAGKVVAAWGRKPDAPLPSAD
KVLSPELDEYQGAFDIAFLGQRYGEARYGLDTRFLGTARRELLHQSIGIAIAEVVLTVTL
LAAIGYWLTRHLTMLTRASLKVAGGDFSFRLKLEGRDEIALLTQAFNAMSSAVESRIQDL
DDSQKRFRAIADFTYAWENWFDTDGHLRWVNPAVERVTGYSVAECHKMEGFPLPLVVEDD
RPQVSEFLSAAQRGQSGQDMEFRIRNKAGDVLWVAMSWQPIFDGEGAPLGSRSSIRDVTL
QKHSSDVAVEAKAELERMLFAASHDLQEPIRYILAYTQRLDREFGTELPERAQSSMTFIR
EGANQLSLLVKGLVDYTRSNRPMTAFAPVDCRRVVDQAIADCNANSGANPPQFRVGDLPV
VQADPVLLFILFENLISNAIKFVRPEVSPQVLITAEAEGEGWRIDIGDNGIGIDPQYLQT
IIRPFSRLHSRSTFPGAGLGLASALKVAKIHGGRLWLESEPGKGTTVHVWLPTEARPDGV