Protein Info for AMB_RS17470 in Magnetospirillum magneticum AMB-1

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details PF00672: HAMP" amino acids 178 to 226 (49 residues), 37.6 bits, see alignment 2.2e-13 PF07228: SpoIIE" amino acids 309 to 507 (199 residues), 92.2 bits, see alignment E=4.3e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3453)

Predicted SEED Role

"FIG017431: Sigma factor-like phosphatase with CBS pair domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1L8 at UniProt or InterPro

Protein Sequence (509 amino acids)

>AMB_RS17470 HAMP domain-containing protein (Magnetospirillum magneticum AMB-1)
MSQDGTPSSQDLAMGRGLAVKMFAATMPVLVLVVLLTQAGLGWINYHARLGALANRADLI
ATLTAQAIARPLWNLDRPIYQAQVEALTSDPGFLQARVLDETGQPVLALGSAPAADGTSL
TVLKPVIEPGGTKTIGTFELTLSKAELEKDDRIQIGLGVGTVLVLLVTAFAILHNATRRL
ILGPLGRLLDAMARVERKDWTQVGWSSGDEIGRVVTAFNHMVDGLRSGDEAKRLLRELEI
AQSRLIENNAALEAANRLVLDSIGYARKIQDGLLPDASTLGDSVREFHVSWNPLQQVGGD
YYWLHRLGRRATLLLADCTGHGVPGAFMTVVVATALDRILVEGGEMLPSEILCRLDKAVR
ERLRQDRPDGSSDDGLDAAVCLWDGETQTLTFAGANLPLVTCRDGQIGVVKGNRHSLGYR
TGATPQSFDDHVLPMEPGTAVYLFTDGMTDHVGGEPPRLYGRRRLLDLIQATSHLALHLQ
VDRIEQALAEHRGGQNRRDDMTIMAFRPY