Protein Info for AMB_RS17440 in Magnetospirillum magneticum AMB-1

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 PF00072: Response_reg" amino acids 27 to 136 (110 residues), 31.8 bits, see alignment E=2e-11 PF00512: HisKA" amino acids 213 to 279 (67 residues), 44.4 bits, see alignment E=2.1e-15 PF02518: HATPase_c" amino acids 323 to 430 (108 residues), 97.7 bits, see alignment E=8.5e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3447)

Predicted SEED Role

"FIG066100: Diguanylate cyclase (GGDEF domain) with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1M4 at UniProt or InterPro

Protein Sequence (463 amino acids)

>AMB_RS17440 signal transduction histidine kinase (Magnetospirillum magneticum AMB-1)
MAEPRKLSLRPRGDSSVHAPAAPPWPVLIVDDDEQVHQMTQVILRDLSYQGRPFKCIEAT
SAAEAAAILDLQPEIPVVLLDVVMETPDAGLRLVRHIREELGNRRIRIILRTGQPGDAPE
RDVVLGYDINDYKSKAELTAQKMFTALVGALRAWNDITTIERLNAELTELNASLEVKVED
RTADLRESNEALARSKTRAETALLRETEAKSQLRQFLSMVSHEFRTPLAIIDSSAQMLRI
RVEKSDPGSVARLDTIRGGVQRLLGLIDTCLADEQLESGRIVLHEKSFDIGPMIEVTLSH
YRVASPTHRYCAEFPPGLAVWGDPGMIALVINNLVGNAVKYSPAGSDILVAAAVDGADVA
LSVTDQGMGIPEEDRDNIFERFHRAANSKGLPGSGIGLHMVRQIVEMHGGTVSVKSRLKR
GSCFTVRLRPSPGPGAEGIDPVQDGLSAPAPDDTVDDLGEGNR