Protein Info for AMB_RS17400 in Magnetospirillum magneticum AMB-1

Annotation: esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00561: Abhydrolase_1" amino acids 17 to 128 (112 residues), 69.3 bits, see alignment E=1.1e-22 PF12697: Abhydrolase_6" amino acids 18 to 249 (232 residues), 84.9 bits, see alignment E=3.2e-27 PF12146: Hydrolase_4" amino acids 18 to 119 (102 residues), 29.6 bits, see alignment E=1.1e-10 PF00756: Esterase" amino acids 67 to 107 (41 residues), 24 bits, see alignment 7.5e-09

Best Hits

Swiss-Prot: 45% identical to ABHDB_BOVIN: Protein ABHD11 (ABHD11) from Bos taurus

KEGG orthology group: K01175, [EC: 3.1.-.-] (inferred from 100% identity to mag:amb3441)

Predicted SEED Role

"Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC 2.3.1.168)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 2.3.1.168)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 2.3.1.168 or 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1N0 at UniProt or InterPro

Protein Sequence (256 amino acids)

>AMB_RS17400 esterase (Magnetospirillum magneticum AMB-1)
MRLHAITAGHGAPHGVPLLILHGLLGSARNWGAVVKTLGETRRVLALDLPNHGASPWTEI
MDYPFMARELAAVIDHLGGRAAVMGHSMGGKAAMTLALTRPDMVERLVVVDIAPVSYSHT
FAPYIKAMRGVPLAEISSRGEVEAALAAAIPDKGVRAFLMQNLEGGAGGYRWRPNLAVLG
AHMDDILAFPPFPDGACYEGPTLFVAGETSDYIRPAHEDVIAQFFPRAETVEVPGAGHWV
HADNPSGFMAAIGSFL