Protein Info for AMB_RS17400 in Magnetospirillum magneticum AMB-1
Annotation: esterase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 45% identical to ABHDB_BOVIN: Protein ABHD11 (ABHD11) from Bos taurus
KEGG orthology group: K01175, [EC: 3.1.-.-] (inferred from 100% identity to mag:amb3441)Predicted SEED Role
"Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC 2.3.1.168)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 2.3.1.168)
MetaCyc Pathways
- 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.1.-.-
Use Curated BLAST to search for 2.3.1.168 or 3.1.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2W1N0 at UniProt or InterPro
Protein Sequence (256 amino acids)
>AMB_RS17400 esterase (Magnetospirillum magneticum AMB-1) MRLHAITAGHGAPHGVPLLILHGLLGSARNWGAVVKTLGETRRVLALDLPNHGASPWTEI MDYPFMARELAAVIDHLGGRAAVMGHSMGGKAAMTLALTRPDMVERLVVVDIAPVSYSHT FAPYIKAMRGVPLAEISSRGEVEAALAAAIPDKGVRAFLMQNLEGGAGGYRWRPNLAVLG AHMDDILAFPPFPDGACYEGPTLFVAGETSDYIRPAHEDVIAQFFPRAETVEVPGAGHWV HADNPSGFMAAIGSFL