Protein Info for AMB_RS17365 in Magnetospirillum magneticum AMB-1

Annotation: acriflavine resistance protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1031 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 338 to 355 (18 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details amino acids 389 to 412 (24 residues), see Phobius details amino acids 433 to 457 (25 residues), see Phobius details amino acids 465 to 489 (25 residues), see Phobius details amino acids 530 to 548 (19 residues), see Phobius details amino acids 861 to 879 (19 residues), see Phobius details amino acids 886 to 904 (19 residues), see Phobius details amino acids 910 to 936 (27 residues), see Phobius details amino acids 960 to 978 (19 residues), see Phobius details amino acids 990 to 1015 (26 residues), see Phobius details PF00873: ACR_tran" amino acids 6 to 1015 (1010 residues), 1021.6 bits, see alignment E=0

Best Hits

Swiss-Prot: 52% identical to MDTC_ECO7I: Multidrug resistance protein MdtC (mdtC) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K07789, RND superfamily, multidrug transport protein MdtC (inferred from 100% identity to mag:amb3433)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcA; Cation efflux system protein CusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1N8 at UniProt or InterPro

Protein Sequence (1031 amino acids)

>AMB_RS17365 acriflavine resistance protein B (Magnetospirillum magneticum AMB-1)
MDGGFSAIFIRRPVATLLLAVGLFLTGMVAFDRLPVAPLPKVDFPTIAVSARLPGADPAT
MAATVAAPLERRLGEIPGVAEMTSTSTQGSTSITVQFDLDRSINGAAHDVQAAINAAASE
LAVDLPSPPTYRKINPAESPILILAVTSDSLTSAKVFDAADAILASRISQVDGVAQVSLS
GAEKPAVRVRVNPGQLASMGVGLEDVRTALAQANVNTPKGFLDGATEAMSINANDQLFTA
SAYAPLIVKSSNGAIVRLSAVASVVDSVENTRLGGWFNRDKGVLIIISKQPGANVVETVD
RIKEILPQLRRWMPAGTKVSVVSDRTINIRGNLDDVETTLAISIGLVIMVVYLTLGRMTP
TVAASVTVPLSLAATFAFMWLAGYSLNNISLMAVTISVGFVVDDAIVMIENITRHMEKGE
GPLEAAIKGSKEIVFTVVSITLSLVAVFIPLLFMGGILGRLFREFAVTLSVAIIVSAVVS
LTVTPTLFGHLMVRAKPRPLSGLAKAGDTAMVWLERAYERTLARALAHRWLMLAVTLGTV
GLTVFLYGQVAKGFFPPQDTGLVFASVEGRVDISFRSISERQQKVAEVILSDPAVEGLGS
FVGSGGGPGGQGNTGRMFISLKPLGERKDSAQDVINRLRPKLGRVEGVSVFLMAGQDIRI
GGRMGKAQFQFVLWSESLEELRQWTPKLVERLKAEPGLLDVSSDQDAAIPQMQVVVDRDA
AARLGVSMTDVDQVLQNAFAQRQVSTIYTQRNQYKVVLEVDPRFQEDPSSLHLLWVKSND
GRQVPLESLARFESSTAPVSVAHQGQFPAATLTFNLAPGVPLGDAAIRLQAAAREIGLPA
GVRWEFAGNAKVFAESLRDQPVLIGAALLAIYIVLGVLYESLLHPITIISTLPSAGIGAL
LALMGTNTELTLISVIGVFLLMGIVKKNGILMVDFAIEAERRGAQPLEAILEACRTRFRP
ILMTTLTALLGAVPLALASGPGGALRRPLGIAIVGGLLLSQLLTLYTTPVVYLWLARLSA
WRKGRKAEAAA