Protein Info for AMB_RS17335 in Magnetospirillum magneticum AMB-1

Annotation: N-acyl-L-homoserine lactone synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF07992: Pyr_redox_2" amino acids 10 to 286 (277 residues), 184.7 bits, see alignment E=4e-58 PF00070: Pyr_redox" amino acids 155 to 222 (68 residues), 42.4 bits, see alignment E=1.3e-14 PF18113: Rbx_binding" amino acids 314 to 383 (70 residues), 82.4 bits, see alignment E=2.3e-27

Best Hits

Swiss-Prot: 41% identical to RURE_ACIAD: Rubredoxin-NAD(+) reductase (rubB) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K05297, rubredoxin-NAD+ reductase [EC: 1.18.1.1] (inferred from 100% identity to mag:amb3427)

Predicted SEED Role

"Rubredoxin-NAD(+) reductase (EC 1.18.1.1)" in subsystem Rubrerythrin (EC 1.18.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1P4 at UniProt or InterPro

Protein Sequence (387 amino acids)

>AMB_RS17335 N-acyl-L-homoserine lactone synthetase (Magnetospirillum magneticum AMB-1)
METAATQNGVVILGSGLGGYTLARELRKLDANVAITIVTADGGESYSKPMLSAAFAQGKD
PTTLVQKSAGQMAADLSATILVRHRVAAIRRDAKAVVLRRPDGGEVELGYGRLVLAIGAD
PRAYTVEGSEAARIRTVNDLDDYADWRAALGAGGRVLLVGAGLIGSEFANDLVGAGYGIT
VVDPAPWPLGRLLPQALGEEMARALGAAGVTFHLGRSVARFSAGRAVLDDGTELAFDLAL
SAIGLVPRIRLAAEAGLKVERGIVVDRTLRTSDPAIFAIGDCAETPAGPLPFVLPLMAEA
KTLAATLAGTETELKLPALPVVVKTPALPMAVCPPPPGAAGEWVVEGEGRDRKALFVSPG
GKALGFALSGTRVNERQSLAKEMPDLL