Protein Info for AMB_RS17330 in Magnetospirillum magneticum AMB-1

Annotation: cytochrome c

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00034: Cytochrom_C" amino acids 27 to 118 (92 residues), 32.1 bits, see alignment E=1.2e-11

Best Hits

Swiss-Prot: 62% identical to CYC22_PHAMO: Cytochrome c2 iso-2 from Phaeospirillum molischianum

KEGG orthology group: K08738, cytochrome c (inferred from 100% identity to mag:amb3426)

Predicted SEED Role

"Cytochrome c2" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1P5 at UniProt or InterPro

Protein Sequence (118 amino acids)

>AMB_RS17330 cytochrome c (Magnetospirillum magneticum AMB-1)
MKLQLAAFAAALALAGTALAAEPPAAFSACKTCHKVEAGANGIGPSLHGVAGSKAGTAAA
GFKYSPALTGWGKSWDDANLAAYIANPKDTIPGNKMVFAGLKNPADVSAMVEYLKTLK