Protein Info for AMB_RS17315 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 840 transmembrane" amino acids 49 to 69 (21 residues), see Phobius details amino acids 298 to 315 (18 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details PF02743: dCache_1" amino acids 86 to 304 (219 residues), 54.8 bits, see alignment E=3.9e-18 TIGR00229: PAS domain S-box protein" amino acids 356 to 480 (125 residues), 76.7 bits, see alignment E=8.9e-26 amino acids 483 to 603 (121 residues), 61.4 bits, see alignment E=4.5e-21 PF13188: PAS_8" amino acids 359 to 414 (56 residues), 31.5 bits, see alignment 5.1e-11 amino acids 485 to 531 (47 residues), 32.9 bits, see alignment 1.8e-11 PF00989: PAS" amino acids 360 to 470 (111 residues), 51.1 bits, see alignment E=5.2e-17 amino acids 496 to 595 (100 residues), 29.4 bits, see alignment E=2.8e-10 PF08448: PAS_4" amino acids 366 to 474 (109 residues), 49.4 bits, see alignment E=2e-16 amino acids 494 to 599 (106 residues), 32.5 bits, see alignment E=3.5e-11 PF13426: PAS_9" amino acids 369 to 472 (104 residues), 41.2 bits, see alignment E=6.9e-14 amino acids 495 to 597 (103 residues), 51 bits, see alignment E=6.3e-17 PF08447: PAS_3" amino acids 382 to 467 (86 residues), 56.6 bits, see alignment E=1.1e-18 PF00512: HisKA" amino acids 619 to 684 (66 residues), 44.6 bits, see alignment 5e-15 PF02518: HATPase_c" amino acids 728 to 837 (110 residues), 95.1 bits, see alignment E=1.5e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3423)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1P8 at UniProt or InterPro

Protein Sequence (840 amino acids)

>AMB_RS17315 PAS domain-containing sensor histidine kinase (Magnetospirillum magneticum AMB-1)
MVPWLLDQPSACILLRMNEQQPEPPSKAPSQGAGHDVAGLTRPGNSWRARLLAMVVIPCL
AALTIWQAVGSYRKEIADTKHLVEALTRVSEEHIAGVMRSIDQLLSEMEEVAPDGRVADP
QRALAALANRMKFIPEIRSAVFIDARGVMVAGTMPGMAGTDVHDREYFKALAENPTLPIF
ISAPLQSRVVTGNSIIAARPIRTEDGRLAGMVAVSVDPKIFEDELRSVLPSDGGRATLLR
EDGIILARLPNSDAWRGVSVAKGAVMAHLATAPRGTLLGTSATDGHERVIAYRRLEKHPL
VVAVGMSLTEVLMTWSRDTALQGGATLLLALVTFGLAMVSDRRLAERQRVQQALAASEAR
YRMLTEHSPVGVFQADAEGTCLYANERWLELAGRGRSELLGEKWCQVVHPDDREAVAALW
RGHVNGQGEFLAEMRLMRGDGAIRWVRGHAAALSVEEGPAGGLVGTIEDITAAKEAERRL
RLSEEKFAKAFRASPDAMVISLTEDGRYIDLNDAFADMLGYSRLDLMGHTALGMGVWADP
EDRARLVEAARRDGQVVNFETRLRRKNGEVFDTLIAVQKVVLDDLDCLLFICRDVSERKA
MEARSRELLVRLDASNKELEQFAYVTSHDLQEPLRMIAGYAQLIERRYRGRLDDDADEFI
AFLVDGAKRMQAMIRDLLEYSRVERLGGQFESFGMGEVLDDVMANLGAALTETGGRIEVG
PMPQVTADRSQMLRLLQNLIGNALKYRSPDRQPVVTVTAEPGAGGWVISVADNGIGIEPA
YFDRIFLVFQRLHTREHYDGTGIGLAICKKIVERHGGRIWVESEPDRGSVFRFSLAETQG