Protein Info for AMB_RS17265 in Magnetospirillum magneticum AMB-1

Annotation: MexH family multidrug efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 45 to 359 (315 residues), 262.4 bits, see alignment E=2.4e-82 PF16576: HlyD_D23" amino acids 71 to 270 (200 residues), 108.5 bits, see alignment E=4.4e-35 PF13533: Biotin_lipoyl_2" amino acids 71 to 117 (47 residues), 27.4 bits, see alignment 3.4e-10 PF13437: HlyD_3" amino acids 166 to 267 (102 residues), 54.1 bits, see alignment E=3.5e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3413)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1Q8 at UniProt or InterPro

Protein Sequence (374 amino acids)

>AMB_RS17265 MexH family multidrug efflux RND transporter periplasmic adaptor subunit (Magnetospirillum magneticum AMB-1)
MKAKRMIIMLAGSAIVFGGVFGFVAFKNHMIKQFFATMPKPVISVTTAKAQMVDWRVVVP
AVGTLQAVNGVDISGSVAGLVKAISFESGQDVKRGQVLVQLDTDVEMGDLRSAQAELGLA
KTSHDRNMKLVRSDTVSVAALEKTEAELKVKQAKVGGLQAQIAKKTIAAPFDGRLGVRKI
DLGQYVQPGQMVVNLQDLSLMLCDFTVSQKDLSLLGIGQTVRMTTDAWPGVTFEGQVAAI
EPLVDAKTGMVSVQARFPNAEGRLRPGMFARIEIERPAGAPVVTVPGSAVAYNLHGDAVF
VVKEEAGADGKTVSKAERVVVSLGERKDGLVVIKSGVAAGDVVVTSGQVKLEHGSLIHVA
ASDPLKTAAAGTVQ