Protein Info for AMB_RS17230 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 PF02641: DUF190" amino acids 9 to 105 (97 residues), 123 bits, see alignment E=2.4e-40

Best Hits

Swiss-Prot: 46% identical to Y666_PYRAB: UPF0166 protein PYRAB06660 (PYRAB06660) from Pyrococcus abyssi (strain GE5 / Orsay)

KEGG orthology group: K09137, hypothetical protein (inferred from 71% identity to rpb:RPB_2947)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (114 amino acids)

>AMB_RS17230 hypothetical protein (Magnetospirillum magneticum AMB-1)
MRIPKDATLLRIFLGEADRRDGLPLFEAIVQEARQNNLAGATVLRGRMGFGHSSRLHSSK
ILALSEDLPVVVEIVDAPDKIDAFLPILDVMVGDRGLICLERIQVLRYGPNRSV