Protein Info for AMB_RS17225 in Magnetospirillum magneticum AMB-1

Annotation: fluoride efflux transporter CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 99 to 125 (27 residues), see Phobius details PF02537: CRCB" amino acids 6 to 119 (114 residues), 103.9 bits, see alignment E=2.8e-34 TIGR00494: protein CrcB" amino acids 6 to 121 (116 residues), 94.5 bits, see alignment E=2.7e-31

Best Hits

Swiss-Prot: 100% identical to CRCB_MAGSA: Putative fluoride ion transporter CrcB (crcB) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K06199, CrcB protein (inferred from 100% identity to mag:amb3406)

Predicted SEED Role

"Protein crcB homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1R5 at UniProt or InterPro

Protein Sequence (128 amino acids)

>AMB_RS17225 fluoride efflux transporter CrcB (Magnetospirillum magneticum AMB-1)
MLTYALVALGSAIGGTLRYWLSMVIAEASAGTFPWATLVINVAGSAAIGLFATLTSVDGR
VFVPSEWRTFFMVGICGGFTTFSSFSLQTLALAQDGDWLAAGLNVVGSVALCLLAVWLGH
VAATIINR