Protein Info for AMB_RS17135 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 transmembrane" amino acids 37 to 62 (26 residues), see Phobius details amino acids 68 to 93 (26 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 124 to 248 (125 residues), 72.2 bits, see alignment E=2.1e-24 PF13188: PAS_8" amino acids 128 to 171 (44 residues), 25.3 bits, see alignment 2.1e-09 PF13426: PAS_9" amino acids 144 to 240 (97 residues), 40.5 bits, see alignment E=5.8e-14 PF00512: HisKA" amino acids 263 to 326 (64 residues), 37.7 bits, see alignment E=3.4e-13 PF02518: HATPase_c" amino acids 376 to 480 (105 residues), 101.2 bits, see alignment E=9.4e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3387)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1T4 at UniProt or InterPro

Protein Sequence (481 amino acids)

>AMB_RS17135 PAS domain-containing sensor histidine kinase (Magnetospirillum magneticum AMB-1)
MVPGASAESEIVRAGGHGSGVFRDSVVRLLLPLPLNLLFFGGTAFAVLVAELVAALVSLA
MVGHVPPVVWAGAFFAPLVVAPAELAVLVAVIGRMRDEMDRRRQAEQHLLEDMAGRREVE
AELRSNEEKLRAMFEKSPLGMARNRVDGSFLEANPAFLGIVGYDIEDLRSLSYWDLTPVR
FGQDEATQLERLEALGHYGPYEKEYIRKDGRRVPVRLSGMLATGRDGESYIWSIVEDITE
SQAVERALMAKTEELARSNADLEQFAFIASHDLREPLRMVSAYMGMLERRFGPVVGDEGA
EYIAYAKEGAQRMDQLVLDLLEYSRVGRMEEPLEPVPLGEVVDGVVANLSPAIAQYGASV
ECRSPLPAIPAVRGEMAQLLQNLIGNAVKYREPSRPLRVVVSAVRDGEYWQISVADNGIG
ISPEFSERIFRIFQRLHTRDCFEGTGIGLAICKRIVERHGGRIWVNSVPGEGSTFTFTLP
E