Protein Info for AMB_RS17125 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 613 transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 152 to 176 (25 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details PF00664: ABC_membrane" amino acids 44 to 313 (270 residues), 124.8 bits, see alignment E=5.6e-40 PF00005: ABC_tran" amino acids 378 to 525 (148 residues), 116.2 bits, see alignment E=1.9e-37

Best Hits

Swiss-Prot: 53% identical to ATM1_ASPFU: Iron-sulfur clusters transporter atm1, mitochondrial (atm1) from Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to mag:amb3385)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1T6 at UniProt or InterPro

Protein Sequence (613 amino acids)

>AMB_RS17125 ABC transporter ATP-binding protein/permease (Magnetospirillum magneticum AMB-1)
MRRRDPSSWDKGRGQGPGADWTTLRTLFPYLWPPGEAGLRLRVVAAMILLVAAKGVGVGI
PLLYKQAVDTLSASPVLVPLALLVAYGAARVMAGSFAELRDIVFVKVAQRAIRKVGLGVF
THLHRLGLRFHLDRQTGGVSRAIERGTKGIEFLLNFMLFNILPTLLEIGLVTAILWGLYD
GVFALITAVTIAVYIAFTLGVTEWRTKFRRAMNETDSEASTKAIDSLLNFETVKYFCNEA
HEAGRYDKALARYEHAASKSKVTLSLLNMGQGAVIAVGLTLVMIRAAQGVADGTMTLGDF
VLVNSYLIQLYLPLNFLGFVYREIKQSLTDMESMFRLLRENAEIEDAPGAGPLALQGGEV
RFEAVSFGYNPDRRILGGVDFTVPAGKTLAIVGPSGAGKSTISRLLFRFYDVDEGRIVID
GADIRDVTQSSLRAAIGIVPQDTVLFNDTIRYNIAYGRPGASQDEIEAAARLARIDDFVQ
SLPQGYDTRVGERGLKLSGGEKQRVAIARTILKQPAILIFDEATSALDTQTEKEIQESLR
EVSRNRTTLIVAHRLSTVVDADEIVVLEHGRIVERGRHARLLEADGRYAAMWRRQQEAQT
LQRRLATELMGAE