Protein Info for AMB_RS17105 in Magnetospirillum magneticum AMB-1

Annotation: thiol:disulfide interchange protein DsbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 703 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 303 to 327 (25 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details amino acids 388 to 407 (20 residues), see Phobius details amino acids 428 to 458 (31 residues), see Phobius details amino acids 464 to 485 (22 residues), see Phobius details amino acids 505 to 522 (18 residues), see Phobius details amino acids 528 to 546 (19 residues), see Phobius details amino acids 555 to 574 (20 residues), see Phobius details PF11412: DsbD_N" amino acids 56 to 160 (105 residues), 69.9 bits, see alignment E=4e-23 PF28432: DUF8393" amino acids 185 to 286 (102 residues), 66.4 bits, see alignment E=3.6e-22 PF02683: DsbD_TM" amino acids 306 to 520 (215 residues), 61.5 bits, see alignment E=1.5e-20 PF13899: Thioredoxin_7" amino acids 592 to 678 (87 residues), 48.4 bits, see alignment E=1.7e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3382)

Predicted SEED Role

"Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase (EC 1.8.1.8)" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange (EC 1.8.1.8)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1T9 at UniProt or InterPro

Protein Sequence (703 amino acids)

>AMB_RS17105 thiol:disulfide interchange protein DsbD (Magnetospirillum magneticum AMB-1)
MAWLKSIGAWIKAIGIAATLMLTGLSAWAAEPGGSDWATSESGKVRLVSAATATGESGQL
RLGLHFKLEPGWKIYWRTPGDAGYPPKLDWTGSDNLDTPRPSWPAPHRFVLSGLQNYGYV
GEVILPLDARAPDASRPVAARLAVEFLACSQICVPQKVDLRLDLSPGAGQPSAFAHDIGR
FAALVPGDGRRHGLTLDSAEALGGGETSALRLAVSSTERFDAPDAFVEAEEVAAFGQPKV
SLSSDRRRAVFEIPVSPGGLLKPLAGAPMTVTVTDGLRAFETPIQPVPGSAAPASAGGEA
PGLAGMLLVALLGGLILNLMPCVLPVLSIKVLGVLGHGGGERGHVRASFVASGIGIVASF
LALAGLAIGLKQAGAAVGWGIQFQQPGFLALMVVLLALFAANLWGLFEIPMPAFLFNRGG
GVAHHTVLGHFLSGAFATLLATPCSAPFLGTAIGFALARGPSEIVAIFTALGLGMAAPYL
AVAVWPDIALKLPRPGRWMVGVRKALGLALAGTGLWLLSVLMVQAGGLAALATGGAMAAA
VVLLALRSRLPAAARSAVGACVVALAGLALAAPFHGTAGSDGGTGSGGAVAWERFDSQTL
ARLVSDGKVVFVDVTADWCITCKVNKAAVIERGEVASRLSAPGVVALRADWTKPDESISR
YLASFGRYGIPFNAVYGPSAPDGIALPELLSEAEVLAALDKAR