Protein Info for AMB_RS17085 in Magnetospirillum magneticum AMB-1

Annotation: 4Fe-4S dicluster domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13247: Fer4_11" amino acids 90 to 188 (99 residues), 64.7 bits, see alignment E=2.6e-21 PF12797: Fer4_2" amino acids 118 to 138 (21 residues), 25.1 bits, see alignment (E = 4.2e-09) PF12837: Fer4_6" amino acids 118 to 140 (23 residues), 28.3 bits, see alignment (E = 4.3e-10) PF13237: Fer4_10" amino acids 120 to 184 (65 residues), 26.8 bits, see alignment E=1.4e-09 PF00037: Fer4" amino acids 121 to 141 (21 residues), 26.1 bits, see alignment (E = 1.9e-09)

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3377)

Predicted SEED Role

"Sulfite reduction-associated complex DsrMKJOP iron-sulfur protein DsrO (=HmeA)" in subsystem Sulfate reduction-associated complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1U4 at UniProt or InterPro

Protein Sequence (231 amino acids)

>AMB_RS17085 4Fe-4S dicluster domain-containing protein (Magnetospirillum magneticum AMB-1)
MINRRHLLLASGAILIAAPAAAREAGKPATAAQRWGLLIDTGKCGAECTICVEACKAEMG
LAGHDRPRTDAQYIRKVNVKDPATGAGHSVPVMCQHCAKPACVDVCPTGASMKRADGIVL
VDRHICIGCRYCMMACPYKARSFAHEEQTGQQPHLPRGKGTVEGCTLCVHRIDEGRLPAC
AEACAAKAKGAMLFGDLNDPKSEIAQRVAREATTRIRADLGLEPAMRYQGI