Protein Info for AMB_RS17065 in Magnetospirillum magneticum AMB-1

Annotation: nitrate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 69 to 86 (18 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 139 to 166 (28 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details PF02665: Nitrate_red_gam" amino acids 67 to 209 (143 residues), 50.7 bits, see alignment E=9.3e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb3373)

MetaCyc: 62% identical to DsrM (Allochromatium vinosum)
RXN-21586

Predicted SEED Role

"Sulfite reduction-associated complex DsrMKJOP protein DsrM (= HmeC)" in subsystem Sulfate reduction-associated complexes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1U8 at UniProt or InterPro

Protein Sequence (241 amino acids)

>AMB_RS17065 nitrate reductase (Magnetospirillum magneticum AMB-1)
MTIFFAILFSVSTLVFAAGLAMKIAQYARTPAPLKIPTTPAPLTKGGVALRLGREALLFE
SLFRGNKPLWLFAFVFHLGLAVVLIRHARYFETQVGPLVALVQPLAQPAGLAMVAGLALL
LVRRLVVERVRYVTGPSDILMLVLLLGIGVSGMLMKCVVHTDIVAVKAFFTGLMGFELRP
LPADPLLGLHLLLVCLLMIIFPFSKLLHAPGLFFSPTRNQTDNPREVRHLAPWAARLEEK
G