Protein Info for AMB_RS17060 in Magnetospirillum magneticum AMB-1

Annotation: sulfurtransferase TusE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 TIGR03342: sulfur relay protein, TusE/DsrC/DsvC family" amino acids 5 to 110 (106 residues), 164.7 bits, see alignment E=3.8e-53 PF04358: DsrC" amino acids 6 to 110 (105 residues), 158.5 bits, see alignment E=3.5e-51

Best Hits

Swiss-Prot: 60% identical to TUSE_SHIDS: Sulfurtransferase TusE (tusE) from Shigella dysenteriae serotype 1 (strain Sd197)

KEGG orthology group: K11179, tRNA 2-thiouridine synthesizing protein E [EC: 2.8.1.-] (inferred from 100% identity to mag:amb3372)

MetaCyc: 63% identical to DsrC monomer (Allochromatium vinosum)
2.8.1.-

Predicted SEED Role

"tRNA 2-thiouridine synthesizing protein E (EC 2.8.1.-) @ Dissimilatory sulfite reductase, gamma subunit (EC 1.8.99.3)" (EC 1.8.99.3, EC 2.8.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.99.3, 2.8.1.-

Use Curated BLAST to search for 1.8.99.3 or 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1U9 at UniProt or InterPro

Protein Sequence (110 amino acids)

>AMB_RS17060 sulfurtransferase TusE (Magnetospirillum magneticum AMB-1)
MAYTSNGATIEADEEGYLTDINQWNEDLAGQIAKDEGITMSPEHWEVVNFLREYYAEYQI
APAVRVLTKAIAKKMGPDKGNNKYLYELFPYGPGKQACKIAGLPKPTGCV