Protein Info for AMB_RS17055 in Magnetospirillum magneticum AMB-1

Annotation: sulfurtransferase complex subunit TusB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 TIGR03011: sulfur relay protein TusB/DsrH" amino acids 4 to 101 (98 residues), 101.8 bits, see alignment E=8.8e-34 PF04077: DsrH" amino acids 9 to 96 (88 residues), 98.6 bits, see alignment E=9.6e-33

Best Hits

KEGG orthology group: K07237, tRNA 2-thiouridine synthesizing protein B (inferred from 100% identity to mag:amb3371)

MetaCyc: 62% identical to DsrH (Allochromatium vinosum)

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1V0 at UniProt or InterPro

Protein Sequence (102 amino acids)

>AMB_RS17055 sulfurtransferase complex subunit TusB (Magnetospirillum magneticum AMB-1)
MSILHTVNKSPFERSCLDACLGHAQPGDSVLLMEDAVIAALSGTAFEGKMADAAKTLKLN
VLGPDLAARGLDPARVVSGISVVDYAGFVDLAAETKATNAWL