Protein Info for AMB_RS17045 in Magnetospirillum magneticum AMB-1

Annotation: sulfurtransferase TusD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 PF02635: DsrE" amino acids 1 to 117 (117 residues), 105.6 bits, see alignment E=9.9e-35 TIGR03012: sulfur relay protein TusD/DsrE" amino acids 2 to 117 (116 residues), 154.5 bits, see alignment E=6.3e-50

Best Hits

Swiss-Prot: 59% identical to DSRE_ALLVD: Putative sulfurtransferase DsrE (dsrE) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: K07235, tRNA 2-thiouridine synthesizing protein D [EC: 2.8.1.-] (inferred from 100% identity to mag:amb3369)

MetaCyc: 59% identical to DsrE (Allochromatium vinosum)

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusD"

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W1V2 at UniProt or InterPro

Protein Sequence (119 amino acids)

>AMB_RS17045 sulfurtransferase TusD (Magnetospirillum magneticum AMB-1)
MKFAILVNEGPYNHQAADSAFQFCKAAIDKGHEIFRVFFYYDGVNNATSLGQPPSDDRNV
TKNWQKLAEENKVDLVVCVAAGLRRGITESNLAQGFRISGLGQLIEAGIHADRLVTFGD